SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014682073.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014682073.1.49734
Domain Number 1 Region: 2164-2257
Classification Level Classification E-value
Superfamily C-type lectin-like 1.74e-31
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 509-647
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-29
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1428-1476,1554-1668
Classification Level Classification E-value
Superfamily FAS1 domain 7.06e-28
Family FAS1 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1669-1823
Classification Level Classification E-value
Superfamily FAS1 domain 1.03e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 385-501
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-19
Family FAS1 domain 0.0051
Further Details:      
 
Domain Number 6 Region: 2255-2418
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-17
Family FAS1 domain 0.0097
Further Details:      
 
Domain Number 7 Region: 923-1077
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-17
Family FAS1 domain 0.0058
Further Details:      
 
Domain Number 8 Region: 1085-1209
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000772
Family FAS1 domain 0.009
Further Details:      
 
Domain Number 9 Region: 1500-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000407
Family Merozoite surface protein 1 (MSP-1) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014682073.1.49734
Sequence length 2527
Comment PREDICTED: stabilin-1 isoform X2 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MAGPRGLLLSLLAFCLAGSGFVMGQKVLSRRCDVKTKFVTHMPCTLCPIIKKQTCPPGWL
REFPGKISQDCRYEVQLGDSLVSMSGCSLECWKDVVQKACCPGYWGSQCYECPGGAKTPC
NGHGTCLDGIDRNGTCVCQENFSGSACQDCQDPNRFGPDCQSVCSCVHGVCRHGPLGDGS
CLCFAGYTGPRCDQELPVCQALHCPQNAQCSAEAPTCSCLPGHTQQGSECRAPDPCRPSP
CSPLAQCSVSPRGQAECRCPENYHGDGMVCLPQDPCTTNHGGCPSNSTLCLYQRPGKASC
SCKPGLVSINHNASTGCFAYCLPNSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHLL
HEVQKASQTSTAFLRLRIALAMLDQGCREVLTTSGPFTVLVPSISSIFPRTMNASIAQQL
CKQHIIAGQHILEELGTQHTHKWWTLAGQEITVTFNRFMRKYTYKYKDQPQQTFTIHKAN
YPAVNGIFHVVTALRWQPPTELPEDPKRTISQILASTEAFSRFETILENCGLPSILDGPG
PFTVFAPSNEAVDRLRDGRLIYLFTAGLSKLQELVRYHIYSHGQLTIEKLISKGRVLTMA
NQVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGILLPPTILPILPKHCNEEQH
KIVAGSCVDCQALNTSTCPPNSVMLDIFPEECVYTYDPSGLNVLKKGCARYCNQTILKPG
CCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDQ
CQEDCGCVHGLCDNRPGSGGVCQSGTCAPGFSGRFCNESTGSCGPTEQAQHCHLHARCVT
QGRVARCLCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGTMGTHHCTCHKGWSGDG
RVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYMCSPIDPCRAGNGGCH
DLWIKSAGITLPADSRVTALVPSESAIRRLSPEDQAFWLQPRMLPQLVRAHFLQGSLSEE
ELARLGGQDVATLSPTTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPKGA
MPVGQGLLQRLDSVPAFRLFRELLQHHGLVPQIEAATAYTIFVPTNHSLEVQGNRSSLDA
DTVRHHVVLGEALSVEALQRGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPLLDAPGG
SLFGLSGVLTVGSSRCLHTHAEALREKCINCTRKFRCTQGFKLEDTPKKSCVYQSGYSFS
QGCSYTCAKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCQEGFHG
TACEMCELGRYGPNCTGVCDCAHGLCQEGLRGDGSCVCSVGWQGLRCDQKITGLQCPKKC
DPNANCVQDSATAPACICAAGYSGNGIYCSEVDPCAQDHGGCSPHANCTKVAPGQRTCTC
QDGYTGDGELCQEVNSCLVHHGGCHLHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPC
SQNNGGCSPYAVCKSIGDGQRTCTCDAAHTVGDGFSCRARVGLELLRDRHASFFSLHLLE
YKELKGNGPFTIFVPHADLMTNLSQDELARIRAQRQLVFRYHVVGCRQLRSQELLEEGYV
TTLSGHPLRFSEREGSIYLNDYARVVSSDQQAVNGILHFIDRVLLPPDALHWEPDAAPIP
RRNVTAAAESFGYKIFSSLVTVAGLLPLLQDGSHRPLTMLWPTDSALRALPRDQQAWLYH
EDHRDKLAAILRGHVIRNVEALASDLPNLGPLRTMHGTPISFSCSRARPGELMVGEDDAR
IVQRHLPFEGGLAYGIDQLLEPPGLGARCDRFETRPLHLKICSICGLEPPCPQGSQEQGS
PEACWRYYSKFWMSPPLYSLALRGIWPQPSLWGPPQGLGRGCHRNCVTTTWKPSCCPGHY
GSECRACPGGASSPCSDHGVCMDGMSGSGQCRCRSGFAGTACELCAPGAFGPHCQACRCT
SHGRCDEGLGGSGSCFCDEGWTGSRCEVQLELQPVCAPPCAPEAVCRVGNSCECSLGYEG
DGHTCTVADLCQDGHGGCSEHANCSQVGTVVTCTCLPDYEGDGWSCRARDPCADGHRGGC
SEHADCLNTGPNTRRCVCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQE
KRAGVFHLQATSGPYGLNFSEAEAACGAQGAVLASLPQLSAAQQLGFHLCLVGWLANGSA
AHPVVFPAADCGDGQVGVVSLGTRGNLSERWDAYCYREQDVACQCRDGFVGDGTSVCNGK
LLDVLATTANFSTFYGMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSG
PDLELHASNTTFLSTNASQGTMLPAHSGLSLVISDVGPDNSTWVPVAPGAVVVSRVIVWD
IMAFNGIIHALASPLLAPPQPHAVVAPEAPSVAVGAGAVVATGALLGLVAGALYLRARGK
ATGFGFSAFQAEDDADDDFSPWQEGASPTLVSVPNPVFGSHDAFCEPFDDSLLEEDFPDT
QRILAVK
Download sequence
Identical sequences XP_014682073.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]