SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014683703.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014683703.1.49734
Domain Number 1 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 411-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 10-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-20
Family KRAB domain (Kruppel-associated box) 0.00042
Further Details:      
 
Domain Number 8 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 338-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 620-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000154
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014683703.1.49734
Sequence length 695
Comment PREDICTED: zinc finger protein 709-like isoform X4 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MPGDPGQSAMDSVAIGDVAVNFTPEEWALLDPSQKRLYRDVMEETFRNLASVGKTWEDHD
IEDQYKNQGRRQRSHMVGRLFESEEGGQCGENFSLLPNLKLKKKTTAKPYKCSAYGKVFM
HHSSLNRHVRCHTEHKPYAYQKCAEKPYKCKECGKAFPFPSSLQIHERTHTGERPYECRN
CDQAFTFSKSLRIHERIHTGEKPYDCKECGKAFSAPSSLPSHMISHTGDGPYKCKECKKV
FVSPRSLQIHERRHTGEKPYECKNCGKAFSHPNTFRMHERRHTGKRPYKCNECGKAFIAV
TNLQVHMITHTGDGPYKCKECGKLFIHPSSFRIHERSHTGEKPYECKECGKAFSLSTNLK
KHKRTHTGGTPFVCKECGNAFNSLQVFQIHERNHTREKPYECKKCNKALSSSSSLRRHER
NHTGEKPYECKKCNRIFCFPSSLRVHERIHTGEKPYECKECGKAFITPSSLRSHMILHTG
VGPYKCNKCEKVFISESSRQKHERRHTGEKPYGCKECSKVFSYTSSLRKHERTHTGEKPY
ECQKCSKSFTSSSSLRVHERIHTGEKPYECKECGKAFIDSSSLRSHMMYHMESRPYKCKE
CEKAFIYPRLLQRHERTHTGEKPYECKECGKALISHQSFQIHKRNHIGEKPYKCKKCSKA
FSFPSSLRKHERTHTGEKSYECQESWKALVSHADF
Download sequence
Identical sequences XP_014683703.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]