SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014684130.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014684130.1.49734
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.26e-35
Family SCAN domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 513-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 213-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000144
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014684130.1.49734
Sequence length 577
Comment PREDICTED: zinc finger protein with KRAB and SCAN domains 8 isoform X1 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MAAESRKSLAPSPPDQAPEEDLVIVKVEEDHGWDQESSLHENNPPGQELFRLRFRKLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEDLQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVPARAHGHRVMWEELVHSESAPKSPDTQLQPVATQQKSPVL
QGPQERAISTQSPAPPQKGSPGDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDPSQK
DLSRDNRPENYRNMFSLGGETRNENRELASKQVISTGIQPHGETAAKCNGDVIGGLEHGE
ARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFSY
RSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAGL
ILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGHQ
RSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIHT
GEKPYQCNECGKAFIQRSSLIRHQRIHSGEKPESIGV
Download sequence
Identical sequences F6QT97
9796.ENSECAP00000008580 ENSECAP00000008580 ENSECAP00000008580 XP_014589751.1.31192 XP_014684129.1.49734 XP_014684130.1.49734 XP_014684131.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]