SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014686748.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014686748.1.49734
Domain Number 1 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 187-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.00072
Further Details:      
 
Domain Number 7 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 621-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 149-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 11 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 105-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000042
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014686748.1.49734
Sequence length 678
Comment PREDICTED: zinc finger protein 709-like [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MYPTLHTFVVFQDSVAVEDVAVNFTPEEWALLDPPQKKLYRDVMWETFRHLASVGITWED
CDLQDQYKDQGRKVRKHRVGRLCESEEDSQRGENFILLPNLSLNKKTTGAIPFGCSACGR
VFMHHSSLNAHIRCHTEHKTYEYQKYGEKPYKCKKCGKSFTYHSLLQRHERTHTGEKPYE
CNKCSKAFTCSSHLRLHERIHTGEKPYECKKCSKAFTSSSCLQLHERTHTGEKPYECKKC
SKAFTSSGHLHRHERIHTGEKPYECKKCSKAFTSSSCLQLHERTHTGEKPYECKKCSKAF
TSSGHLHRHERIHTGEKPYECKKCSKAFTCWRYLQRHERIHTGEKPIECKKCSKAFTSSS
CLQKHERIHTREKPYKCKRCIKAFASSSCLQKHERIHTGEKPYKCKRCIKAFASSSSLRL
HERTHTGEKPYECKKCSKAFACSSHLRVHERSHTGEKPFECKICGKAFACSSHLRVHGRS
HTGEKPFECKICGKAFACSSHLRVHERSHTGEKPFECKICGKAFISTGSLSTHERTHTRQ
KSYECKICNKAFSSSSSLQRHGRTHTGEKPFECKNCSKAFTCSSSLRIHERAHSGEKPYE
CKECNKAFTASKYLRVHEKSHTGEKPFECKICGKAFISTSSLSTHERTHTRGKPYECKIC
NKAFSSSSSLQRHERTHR
Download sequence
Identical sequences XP_014686748.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]