SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014691290.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014691290.1.49734
Domain Number 1 Region: 90-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 298-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000366
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 501-538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 211-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 257-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 462-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014691290.1.49734
Sequence length 819
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MEGECGELSTGSGFLCVLRGFRPCGLRGGNGSDPVVPDRDLYEETRPAVWAVSSCAPVRA
AAPLSPFVSPAVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCS
WYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISARD
HVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGD
GSDEGNCSAPASEPPGSLCPGGTFPCSGLRSTRCLPAERRCDGTQDCGDGSDEAGCPDLA
CGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEG
LGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQ
PCGSSGDGDAGDPGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAP
ADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAV
PRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSY
GQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRPSRRRLGRLWNR
LFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAAPDPPAPRTDTGSPGAAGDGLPSA
HCHAPEVGPSVPDPLGLREPECGPVDKDRKACRDPLVDSPAPMDTPRELCLAQDPQPPAP
TASSTLGPHPPEPLGVCRSPPPPCSPALEASDDEALLVC
Download sequence
Identical sequences XP_014691290.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]