SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014691796.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014691796.1.49734
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily vWA-like 6.53e-39
Family Integrin A (or I) domain 0.0000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014691796.1.49734
Sequence length 488
Comment PREDICTED: anthrax toxin receptor 2 isoform X1 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MVAGLSLARSPGSWLVPGLWLLVLSGPGGLVSAQEQPSCRGAFDLYFVLDKSGSVANNWI
EIYDFVKQLTERFVSPQMRLSFIVFSSQATIILPLTGDRGKISQGLEDLKHVRPVGETYI
HEGLKLANDQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKLSRSLGARVYCVGVLD
FEQAQLERIADSKEQVFPVTGGFQALKGIINSILAQSCTEILELRPSSVCVGEEFQIVLN
GRGFNLGSRNGSVLCTYTVNETYTKSVQPVSVELNSMLCPAPTLNKAGETLDVSVSFNGG
KSVISSSLIVTATECSNGIAALIAILVLLLLLAIGLMWWFWPLCCKVVIKDPPPPPPPAP
KEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVTIPE
ETEEPVRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEGRCI
NFSRVPSQ
Download sequence
Identical sequences F7AN24
ENSECAP00000016060 ENSECAP00000016060 9796.ENSECAP00000016060 XP_001492635.1.31192 XP_008516753.1.77740 XP_008516754.1.77740 XP_014691796.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]