SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014693863.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014693863.1.49734
Domain Number 1 Region: 19-515
Classification Level Classification E-value
Superfamily Sema domain 1.29e-99
Family Sema domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1379-1504,1670-1826
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 856-947
Classification Level Classification E-value
Superfamily E set domains 0.000000000000128
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 4 Region: 951-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000000233
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.051
Further Details:      
 
Domain Number 5 Region: 1034-1115
Classification Level Classification E-value
Superfamily E set domains 0.0000000000056
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 518-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000112
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014693863.1.49734
Sequence length 1894
Comment PREDICTED: plexin-D1, partial [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
LLPLLLLLGTARAGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEA
EAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLR
RRGNISAVAVRFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGTGGSRLLVGA
TYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGA
KEQHKLGFVRAFLHPPDPPPGAPSYAYLALNSEARAGDKESQAQSLLARICLPRGAGGDA
KKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPASELLFAVFERPQGPPAARAAPAALCAF
RFADVQAAIRAARTACFEEPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQ
HPLSVLQPLKAAPVFRAPGLSSVAVASVSNYTVVFLGTVSGRLLKINLNESMQVVSRRVV
TVAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACAMHTTCGDCVGAADAYCGWCAL
ETRCTLQQDCANSSQWHFWTSASKGPGGCPAMTVLPAEIDVRQEYPGMILQISGSLPSLS
GMDMVCDYGHNIRTVARVPGPAFGHQIAYCNLLPRDQFPPFPPHQDHVTIEMSVRVNGRN
IVQANFTIYDCSRIGQVYPHTACTSCLSAQWPCFWCTQQHTCVSNQSRCEASPNPTSPQD
CPRILPSALAPVPTGGSQSIPVHLANAAFFQGAALECSFGPEEIFEAVWVNESAVRCNQV
VLHTTQKSQVFPLSLQVKGRPARFLDSPDPMTVEVYNCAMGSPDCSQCLGREDLGHLCVW
SDSCRLRGPLQSLPGTCPAPEIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGS
VACEPLADRYTVSEEIVCATGPAPEAFSDVVTVNTSKEGKSRERFSYVLSLVHSLEPAMG
PKAGGTRITIHGSDLHVGSELQVLVNDTEPCTELVRRDTSITCMVPGAALPAPVPVCVRL
ERRGCLRGNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREP
TLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYADEVAVAEELLDPEEAQRGSPFRLD
YLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLERHEYRVKIGQVACDIQIVSDRV
IHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIVVSIVICSVLLLLSVVALF
VFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEY
KHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGIS
LFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLI
DASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSID
AITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAF
CKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNALAHYKIPEGASLA
MSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTK
GTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRF
WVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEY
RKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMTA
LEANPTARRSQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_014693863.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]