SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014694222.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014694222.1.49734
Domain Number 1 Region: 180-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 243-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000162
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 3 Region: 56-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000513
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 117-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000275
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014694222.1.49734
Sequence length 492
Comment PREDICTED: sushi domain-containing protein 4 isoform X1 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADP
GVPENGFRTPSGGVFFESSVTRFHCQDGFKLKGSTKRLCMKHLNGTLGWIPSDRPVCVQE
DCRVPQIEDAEIHNKTYRHGDKLIITCHEGFKIRYPDLYNMVSSCRDDGTWDNLPICQGC
LRPLASSNGYVNISEFQTSFPVGTVIAYHCFPGFKLEGSEFLECLHNLIWSSSPPRCLAL
EAQVCPLPPMVSHGDFICHPRPCDRYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSY
QVYCIKSEQTWPGTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPR
SSSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYLASVGQGCPLPEDDQSPPAYPGSG
DTDMGPGESETCDSVSGSSELLQSLYSPPMCQGGTRPASDNPDTVASTAEEVASTSPGID
IADEIPLMEEDP
Download sequence
Identical sequences F6SIP8
9796.ENSECAP00000010299 ENSECAP00000010299 ENSECAP00000010299 XP_014694222.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]