SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014699357.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014699357.1.49734
Domain Number 1 Region: 8-238,310-338
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 9.94e-60
Family Creatinase/aminopeptidase 0.00014
Further Details:      
 
Domain Number 2 Region: 235-311
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000898
Family Methionine aminopeptidase, insert domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014699357.1.49734
Sequence length 394
Comment PREDICTED: proliferation-associated protein 2G4 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISSGEGKAKDA
GQRTTIYKRDPSKQYGLKIKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTAENATSGETLEENEAGD
Download sequence
Identical sequences F7CMH2
ENSECAP00000005241 XP_008528370.1.77740 XP_014642089.1.5094 XP_014699357.1.49734 9796.ENSECAP00000005241 ENSECAP00000005241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]