SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014704093.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014704093.1.49734
Domain Number 1 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-23
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.00053
Further Details:      
 
Domain Number 7 Region: 659-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-20
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-20
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-18
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 130-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000123
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014704093.1.49734
Sequence length 722
Comment PREDICTED: zinc finger protein 709-like [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MFGDGRIICNLPTKGGWMSRAVCLVFPTLHIFVMFQDSVAIEDVAVKFTPEEWALLDPSQ
KKLYRDVMQETFRHLASVGKTWEDHDIEDQHKNWGRKQRSPLVGRLSESEEGSQCGENVS
LIPNLSVNKKTTGGEPCECSDCGKVFRHHSSIKRQVRCHTEHKQDDYQKYAEKPYVCKEC
EKAFLFPSCLRAHERTHTGEKPYECEECGKAFTAPSSLRSHMISHTGDGPYKCKACEKAF
ITPSSLQIHGRRHTGEKPYECKHCSKAFSLPSVLEIHERTHTGEKPYQCKECGKAFIALK
NLRAHMVTHTGDGPYKCKECGKAFIYPSSLQIHERSHTGEKPYECKKCNKVFACSSSLGV
HERTHTREKPYECKECGQAFRACSSLRSHMMLHTARGPYKCKECGKACIALTSLRVHMVT
HTGDGPYKCKECGKAFIYPSSLQTHERSHTGEKPYECKKCDKVFACSSSLGAHERTHTRE
KPYECKECGQAFRARSSLRSHMMLHTRDGPYKCKECEKLFISPSSLQRHERSHTGEKPYE
CKKCNKVFTSSSSLLVHERTHTGEKPYKCKECGKAFIALRSLQSHVMRHTGDGPYKCKEC
EKAFISPSSLRRHGRSHTGEKPYECKECSKAFTSSSYLRIHERTHTGEKPYECKKCSKAF
HVASSLQRHERTHTGEKPYECKNCSKAFGYSSSLRKHERTHTGEKTYEYQESGKAFISRE
NF
Download sequence
Identical sequences XP_014704093.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]