SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014705695.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014705695.1.49734
Domain Number 1 Region: 199-340
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 490-577
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-26
Family First domain of FERM 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014705695.1.49734
Sequence length 577
Comment PREDICTED: moesin isoform X2 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MPKTINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLALE
MAELTARISQLEVARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENDQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences F6PUX2
XP_001504911.1.31192 XP_008541350.1.77740 XP_014705687.1.49734 XP_014705695.1.49734 ENSECAP00000010937 ENSECAP00000010937 9796.ENSECAP00000010937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]