SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014711409.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014711409.1.49734
Domain Number 1 Region: 135-176
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000201
Family SAP domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014711409.1.49734
Sequence length 187
Comment PREDICTED: cerebral dopamine neurotrophic factor [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MWCTNPAAMVAFCAGLWVFNPVPARGQEAGGRPGADCEVCKEFLNRFYNSLITRGVSFSL
DTIEKELIDFCLDVKGKEHRLCYYLGATKDAATKILSEVIRPMSVHMPAVKICEKLKKMD
SQICELKYEKKLDLASVDLSKMRVAELKQILNSWGEECRACAEKSDYVNLIKELAPKYAA
MHPKTEL
Download sequence
Identical sequences F6WIL8
XP_001498617.1.31192 XP_008527348.1.77740 XP_014711409.1.49734 ENSECAP00000007621 ENSECAP00000007621 9796.ENSECAP00000007621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]