SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014722006.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014722006.1.49734
Domain Number 1 Region: 231-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-63
Family Eukaryotic proteases 0.000000112
Further Details:      
 
Domain Number 2 Region: 51-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-20
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 3 Region: 190-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000035
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014722006.1.49734
Sequence length 490
Comment PREDICTED: complement C1r subcomponent-like protein [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MSGSRCLFSEWGNHLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQKLTSPG
YPEPYLKGQQSSIDIKAPEGFAVRLVFQDFDLEPSQDCERDSVTITASGMDPSRFCGQQG
SPLGSPPGQKEFVSSSSLRLTFRAPASSEDRTTHLHKGFLALYQAVGMNHSRPMSQANGV
SEATHTPGDNPSKIQNHCQEPYYQAVPAGTLSCTSQGPWKETQDSKEAPHCVPVCGRPVT
PITHNQDVLGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSIFPGKNR
SVNVFLGHTNIDEMLKLGNHPVRRVVVHPDYRQNESHNFNGDIALLELQHSVPLGPSLLP
ICLPDSETLYISGLWGYVSGFGVEMGWLTTELKYSRLPVAPREACKAWLQEKQRTEVFSD
NMFCVGDKMRPQSVCQGDSGGVYVVWDDRVHHWVATGIVSWGIGCGKGYGFYTKVLNYMD
WIKGVMDGKD
Download sequence
Identical sequences XP_014722006.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]