SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014730148.1.99236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014730148.1.99236
Domain Number 1 Region: 111-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-23
Family Clostridium neurotoxins, the second last domain 0.041
Further Details:      
 
Domain Number 2 Region: 536-611,644-662
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000125
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1370-1444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 384-477,567-623
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000269
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 5 Region: 1316-1376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000113
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Domain Number 6 Region: 1435-1493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000208
Family Complement control module/SCR domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014730148.1.99236
Sequence length 1636
Comment PREDICTED: pappalysin-2 [Sturnus vulgaris]; AA=GCF_001447265.1; RF=representative genome; TAX=9172; STAX=9172; NAME=Sturnus vulgaris; AL=Scaffold; RT=Major
Sequence
MLRGGAPLAALLLAALSLARGEPPPVSGCGMEAPSRRAVPPHHPYGLYPQGPAAHGALGA
ASSRGRRPRGARGGGEELEGEEDGRGRSRGERRRGREPQVPDPPRERPLPALYFSGGREQ
LAARAEALPAVPREEFTLELWVKAEGGQNNPAIIAGVFNNCSHSASDKGWALGIRALQLS
GKKDARFFFSLRTDRAATATEVTSHHRYRPEAWTHLAASYDGRWMALYVDGVRVGRSSGQ
EGPLHSAFMSSCRTLLLGGDAWGTTHTFRGHLAGLALWHGALSQSHLQRSFLEEVAEETA
GLALAAGFATPEECWMPFREGAYPQQWVLLSPPSPILRPLGPPACGQTACDNVELVSHYN
QHWPLRSWKVVRYRVVNLAEDDGGRPTVSWEQIWRQHRALSEAFRPYNISWQLSLLEVHN
SSLRRRAVLLGCEPSKVGNERCDPECEHPLTGYDGGDCRRPGRCFSWKRRDGVCHMECNN
MLDDFDDGDCCDPRATDVARTCFDPDSPQRAYMSVKELKEALQLNSTHFLNVYFASSVRE
ELAGAATWPWDKEALSHLGGVVLNPAYYGMHGHTNTMIHEVGHVLGLYHVFKGVSERESC
DDPCRETTPSMETGDLCADTAPTPKSKLCRDPDPTNDTCGQTHFMGTPFNNYMSYTDDDC
TNSFTPNQVARMHCYLDLVYQRWGHIKKPAPIPIPPMITGQTQDSLSIYWLPPISGVIHE
REQDTLCDSCAEDGTFRQYVHEASSPRVCDSSGYWTPEEAEGPPDVDQPCEPSLQAWSPE
LHLYDMNMTVPCPQPDGCILELHFLHPVYPDSLTLWTTYLSMGSPKALSDIEILTEQGES
IHLGPLDTFCDVPFTVKLNIPKKMSGVKIYTFDERMEIDTALLTSRPHSSLCSACRLMQY
RVLRDPPFADGSPASPLQAHRQFIDTEVTPGQVYRYQVQVVSHTTSGEASPPLVHMHGAP
YCGDGKVTTSLEEECDDGDLLDGDGCSRKCKKEKGFNCVGEPSLCYIHDEDGVCEPFEKT
SSMVDCGPHTPEGYVDLWAVKAYASQQDAKFCPVSLVTGEPVVKVCKSHLPEVPKDLLQA
AWFPCAPSQENAQDPNKKMLLGDDEEVWIKVCFERPAVPTSLLLFLASSGTVPRQQHKPV
VTVQLTDTDGQNHSLGMYELSCQHNPIVINVTHSQEDPSPQVASVLFNFSSPLVGIAAVA
LRTLAQPGSSEPLTTCILQHEEGCDHQCYSCAHGACMGSGTCTQPLLVHTATLNCSSDGP
RHMTCAVSCEKGFILHSSGGKRLGSMEQEVVLTCSWGQWDRSVTCDPVDCRVPDQSHVYY
AEFSCPVGTTYLQRCSFSCIPPAKLQGTNQWLTCLEDGLWSLPEAYCKLECDSPPAVANA
KLLVPRCLQGNHDVGSVCRYKCKPGYHVAENTADKPKKKFLKVQCLESGQWEEGHCVPVV
CKPPPPVFEGMYNCTQGFELDSQCVLNCEQQGQQVPIVCTKEGLWTEEFKLCESLQGTCS
SPPELNFVEYKCEQGHGIGAVCIPSCIIPPSDPVILPKNVTAETMDHRLQPTRVQNIVCT
GRLRWYPDPSVIHCIQSCEPFQADGWCDTINNRAYCQYDGGDCCSSTLSSRKVIPFAADC
DQDECTCRDPAAEENQ
Download sequence
Identical sequences XP_014730148.1.99236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]