SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014739393.1.99236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014739393.1.99236
Domain Number 1 Region: 435-653
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000331
Family Exportin HEAT-like repeat 0.084
Further Details:      
 
Domain Number 2 Region: 4-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000015
Family APC10-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014739393.1.99236
Sequence length 943
Comment PREDICTED: centrosomal protein of 104 kDa [Sturnus vulgaris]; AA=GCF_001447265.1; RF=representative genome; TAX=9172; STAX=9172; NAME=Sturnus vulgaris; AL=Scaffold; RT=Major
Sequence
MPHKIGFTVVSSSGHEDGFSARELMVHAPTVNGWRSPRLCQYPQEIILQLVERCRIRKLQ
LLAHQYMIASKIEFYISESLPEYFAPYQSERFQRLGYVPLSDNEKTDFRARELKSVYMDA
VGQYLKLIFHKNYANKYNLYGQVALVAVNIIGEPADYGIDSMSSPSRDKLIDHYLGIKLD
DPALDGTYLGKRDSISPLDDLAFDMYQDPEVAQIIRRLDEKKREAVRLECYDHAKKLKQA
IADLQKVGERLGRYEVEKRYAVEKEDYDLAKKKKEQMDEYRLKVYQQLELHDLLDAQLLI
QKPPELPLRSVSGTESSQSSPPELPDPLQGEPRRAEPVLEEQMVDPASSEPLVSYQSPLS
PRTQPTTSKEAFSKENVKFLPYDERPLPACKQVDEAVAYLEPEVTEEDMGDTPRTGNTGE
PEPLTEKALREASPIVEVFGETLVSGAYSRSWSCREDALLTVYKKLMEVSVDTPKEDLRN
MLRAAVFLVKRAIKDTVSSVFQASLKLLKMVITQYIPKHKLGKLETSHCVEKTLPDLLSK
TGDSSSRVRLLASTFIQEVALCPEVKPLQIIPVHLVKTLKPNSPTHLAMSHVELVESLLG
AMGTENSGFTINNVMKFAMGALEHRAHEVREVVLRIIFAMYREHRAAVLEFLPPDDAGAR
KTVRYKTLFEGFAKIDGKSSETELRAQRKAATEAEKQTQEEMKVLKHHSAAQKLELQAEV
EAGEEKESDFEKTKNQGYQVYESPQSTAAKIQEELSSVANYLDNLCIFCGERSESFTEEG
LDLHYWKHCPMLTRCEHCKQMLEIASLTEHLLTDCDKRDSFGKCPRCREAVPRDELPRHI
KSKICNPAKPENVANHCPLCHENFPPGEEAWRSHLMDKDGCKMNQRRTPPMSRTIVLQPA
KVGGHYLRKPGPSGTKLQPPSVGSKIRTRVGPNKSTGKTYSKR
Download sequence
Identical sequences XP_014739393.1.99236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]