SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014766457.1.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014766457.1.52611
Domain Number 1 Region: 632-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 152-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000335
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000819
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 685-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000262
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 549-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000139
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 492-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 603-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000658
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  XP_014766457.1.52611
Domain Number - Region: 438-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000162
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 1263-1289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00832
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014766457.1.52611
Sequence length 1290
Comment uncharacterized protein Dana_GF17472, isoform B [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MNNQGYGGIQWIQHSTAPDVCEVEVLENGAEMAVQEAAAAFVDDGGEEDAEEDLDHMAAE
NLIFMARDGQLSEIIAANEAGGAVLVTADGTTVAYAGSFDDDAQVVTEEVITDDWVQHQG
AERVEIAAEQIAGISSSQELLDMEQDEYTALRPYPCDFCSRRFRKKASLNNHMLAHQNDR
PHLCKLCGARFTRRAELISHFKAHAEAQDAADAEAAAAAAAAAVSASSIKYEYQSQRQLD
EHFYEQEWSLSHQDQGQVRHEQHNHSEQQLISNHDVADAYPALVAPPAAPARGRISRLKP
KEESSQFIVMAERQSSPNLGSNCLSPTEQPTVASAQSGTAEPPPQPNYPILDDKKPFVCQ
QCGLAFAREKALVSHTKNHRMDSPYECNQCQEMFWDNSSLQEHLKTHQFEESNSEYDPAS
AEDSASESEPEEQLYGDFYCAECGISFHRQDLLRRHAKQHIKQPEAQAGERNSTVAAGGE
VDAKESSGGGNSCHTCGKSFPTALEMLAHAEIHSRFPPFKCVLCGISFYEEQAIKRHLHT
RHPNELKANSCVLCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHR
DKSVVCEVCHEEFPDGRTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGE
RPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVA
RNTYHCTVCSEDFPSSNDLIQHLIQHSDSNTAKQRQPITGPRKYKRRRKLQPHEIVQMRA
ESKEANGEGEALGEADRDGEEDDYASDIDICDFDVDQVDDSLFDIAESPKKEKRKRTSAR
TVPKHNASNGGAGTTGGDGSGKPTQSKENTKLRYDSTSSQQSDRIWEEKFLQDSQTPLFQ
IDSLVVVNDTPLPPASPSESAALPKTRAAAKLLSKPAEASTSATVSSYSAASVSRGRKKP
ASKTAGKAPSAISSSSRPRMIHTERARVTKPAVGTDSSSKKTRSKVYVTRTETTSKLGAL
DKSCIVDDYEIISPATQPPNQISSSPLHIKQEQEHQQQRVQLMYDDNLLIDAALLREKTY
EKFNPSIVNDLEEILRSPLKHDRSSRLRFTSESSTTPQFLPEEEQHLIKIEPTSPDLREM
VESQTRVTSSSSSSARTSRHLRQITANNGPRAGSQRFAEKSSPGAGGAHKKATSSASTVS
KVGSSSSYLGYGVEAYSVNQCVPASGSTADVGSGFFSISEVVSAADAADAAAKAAAAGKS
ERKTRFFECEMCTAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences A0A0P8XWP0
XP_014766457.1.52611 FBpp0120664 7217.FBpp0120664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]