SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014777952.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014777952.1.24776
Domain Number 1 Region: 324-591
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-61
Family Kelch motif 0.00033
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily POZ domain 1.31e-30
Family BTB/POZ domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014777952.1.24776
Sequence length 601
Comment PREDICTED: kelch-like protein 9 [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MALGKHGQVSDGADDTLDVRPNEPKEQCRRSEFDSLIPMIDMQSECHGSKLMKGYQKLRD
DEHLFDYTIYVENESISVHKTLLAASSDYFHAMLTGSMKESREDSVTLRGLTAIGVQAII
NFAYTGLLEITSDNIDDILLAASHLQVIDSVELCTEYLVKSINLDSCVDVLILADLYSLV
NAQEKSRDFIRENFERIVTSEKYYQLTHTQLAFLLAGDNLRVTSEYQLVMFVLEWVKWDD
QVRKQYLPQLLENIRLPLLRVDELDKLARLHIMRNNPGCNRLFREAQEYNRNIFKQPMYQ
TKRTQVRSEKVSLVLCHGESPKSYTFKTEKFTTLRNPLIPMYNPGVIVVDNFMYVCGGTC
NNDHNFNASPRCFRFDPRFDTWTEFTSLLEARKDFVMVTVNKTLYAIGGKDKNNISSTME
SYTVESNQWSWRAPINIAVYGHAGDVCKGKIYVCGGQTTTGCVNNFLRYDPSTNTWEDRS
RMLRPRCNHILACVKEKFYAIGGNVEDSHGLASPIDLIESYNPNTDQWTTMEVTVSIRKA
GAFVRDDKIYITGGLKEQRLLEIIQEYDPVKNTLKTSHTFPFVILGRACCLLTLNRCEPF
R
Download sequence
Identical sequences A0A0L8GVB8
XP_014777952.1.24776 Ocbimv22027731m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]