SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014785960.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014785960.1.24776
Domain Number 1 Region: 387-710
Classification Level Classification E-value
Superfamily DNase I-like 3.93e-46
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000071
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-19
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1053-1117
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.96e-16
Family SAM (sterile alpha motif) domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014785960.1.24776
Sequence length 1123
Comment PREDICTED: phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A-like isoform X1 [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MAFLHKGISRLQAEKRLLQNKEDGSFLIRESETVPGAYVLCLLCQGRVHKYRILPDLDGK
LSVQSENSLLEPRFVDLSHLVQEYMKRGDKNGLVCAMKKIVAVERSEKLDEPDSDDDDFE
ANAADPSARHNTVSTLRMQFLKNFARLDLSKTEGEFMTILKQYIDEGQDEDLVSMKAGNT
KLPGLQKLLWTIAKPLVKEFDNFLLKMGLVRDLFSDVPKEQKWKELEAENFGVEEMSNKF
NECKAALEDLQAGAQDFLKNYGIKDQGSHGDYTEIDFDMMKTAPFLQSVPQQPIPEAIFE
VRAVKHGKPMGRVTLKVDVQTGRLFAVKPSKDILDASNTFSHEKILQLIKKSTDNCRLDI
VIEGKKTFTYQFESVHARENFCQHICQMKSMHSTAEEIDQVSIFIGTWNMGTAPFTESLN
SWVRCQGAGKIREPLVMGVIPHDLYVIGTQESSLTEKDWVNCLKAQLRLSMSIDPEIVCV
CSLWGIRLVVFTKAEHQHRISHVEHSSVKTGIANALGNKGAVAISMYFNGTSICFINSHL
ASRSERLARRNQNYRDIIKGLSLGQKHLNVFDVTNQFHHVFWFGDLNYRVEENIHCVLNK
LQEGDIDSLLILDQLKMTQDCKDAFVGFREEAITFLPTYRMERGAKGKLVYNWRKVKKTT
GDRINVPSWCDRVMWRSYPGTFIENIAYGCADDILSSDHRPVFSSFNIGIASQFITNRES
LVDQTSVRIIFDLVQAEIRTCSSQYFVLEFYSNCLPNVISSNPNKTFYAEIAGLCCPQWT
KDSLPELHPIFGDRDYLEEQHILIAIRTRDGDHESYGECVVTLKDMYSVQPEPFEYMLTH
LGDETGIIRGKMHIYTPESAPRRRSSKKVYELVSIDTEYHDPELYLVDSPRLEKLNEGRY
VNAPPFNGFSGAGYPETNPAPVPALPPTTTSVATQVYPPDSQLSGDPWPFGITDKQGVLT
SFETSTDPMLGALPRKGKPYMGQSSLEVGQRPMLPAPVTPVGSTGTSKMTESAVFSFSST
GPESASAEARDATMAPPVPTPRKTKHQSDAGYAHLKKPDTVQEWLGCLGLSEYTNTFIIN
GWDSISYLGYLTNDDLVNMHIRNPKHRDRLLRSLQDMNLKFTG
Download sequence
Identical sequences A0A0L8FXM8
XP_014785960.1.24776 Ocbimv22004752m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]