SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014786995.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014786995.1.24776
Domain Number 1 Region: 76-119
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000419
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014786995.1.24776
Sequence length 121
Comment PREDICTED: uncharacterized protein LOC106881205 [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MADEGDLKQSSYEPETLQHGADNDKTWSVNRTETSSSAGGQRIEFDDRLIEMSSNDSAAK
STYVRNTVPTTENPFEKANRYLYKHNLFSLFQELVMNVAYKQPSDSISFMVNEIEKFRNQ
S
Download sequence
Identical sequences A0A0L8FTQ9
XP_014786995.1.24776 Ocbimv22008098m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]