SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014787852.1.24776 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014787852.1.24776
Domain Number 1 Region: 396-604
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-50
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 89-205
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000105
Family DNA ligase 0.073
Further Details:      
 
Domain Number 3 Region: 223-310
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000974
Family DNA topoisomerase II binding protein 1, TopBP1 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014787852.1.24776
Sequence length 915
Comment PREDICTED: protein ECT2-like [Octopus bimaculoides]; AA=GCF_001194135.1; RF=representative genome; TAX=37653; STAX=37653; NAME=Octopus bimaculoides; AL=Scaffold; RT=Major
Sequence
MAENMNSGISFDTSATPNRQLNAKTLSTRSILKPDLVIKFVVVGESCQKNEQLQKSLQYF
SHPVIYSDTGQDIPAKSPDFEYIFILDNFENEVFRQLYCEKKRIFGPPVLITCARDNLPL
PKYGRPLYCFFMSGLVLCITGIKRKEKMLKLTDVVHHMYGMVKKEISPKVTHLVANCCGN
DKYRFSVNYGIPIMKVDWIMEVWEHRDNIVSRADQELFMSFRLKPFEFCYLSFFGFKDED
QKQMEKLTSENGGTYVNCNDERATHLVVDDQITDDVPVISNPKGFVVRAEWFWGSIQIDA
CACEDIYLFEKKESPEAFTPNYLNNSLKNRKRRLLQDINERLNQDQQTPNWGPKRRSKDF
ADKNMTPVKICQNESLIETRSVEEKCTKDRNALKPSQRCLVAMELLQTEWNYVKILHTIL
HVFKEKIEEPNQYNVPILVPLEIKSIFGKIPPIYDIHCKIRDELSDLINNWKEDALVGDV
ILKHADKLVKAYPPFVNFFEKTKESILECEKKNPRFHAFLKVSLNKPECGRQTLVELMIR
PVQRLGSVILLLNEILKRTLKTNPDSKKLDEAVKALKEVLTYINEDKKKTENRVEMFDLF
NDIECCPPYLLSSHRTFLKKVDTIELYGSVIPRGESLTLFLFSDSLSICKRRLKLMNNAT
KSPSSHKTPQKPFKHLALLPLNSIKAVLDMKETDTCQNAFGLTCNNGDKDEWYAFKMDCD
IPKSEFQMLLCRSIADTLCRTDYEKFFITVDGQTLSVDTRDLTRSRALRIRKKVGRAFSF
SKTPAQLKRAVSSVANGLSPFMKEGLGASVGTLGRSYGYSAHRPNSTLSLNEIDSTLSHI
SEVPLAVGDDTDSISLDDYTLTEEESPSKYSTLPIIIGKKLADYQSDGTTNTLNKYLSRS
TNKGHFERNTQIYHV
Download sequence
Identical sequences A0A0L8FQF4
Ocbimv22011027m.p XP_014787852.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]