SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014802111.1.91963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014802111.1.91963
Domain Number 1 Region: 126-622
Classification Level Classification E-value
Superfamily Sema domain 7.32e-92
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1493-1618,1784-1941
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-36
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 1056-1146
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000687
Family Other IPT/TIG domains 0.055
Further Details:      
 
Domain Number 4 Region: 966-1046
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000255
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 5 Region: 625-677
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000471
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1145-1228
Classification Level Classification E-value
Superfamily E set domains 0.00000000242
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014802111.1.91963
Sequence length 2008
Comment PREDICTED: plexin-D1 [Calidris pugnax]; AA=GCF_001431845.1; RF=representative genome; TAX=198806; STAX=198806; NAME=Calidris pugnax; AL=Scaffold; RT=Major
Sequence
MVQHPCTPALRLATRPRGLGSRIKSDHLKLVLVGIQPKKGFTPLCAPAPTPLRRLQLHCQ
GTGCLQAQPLRGGRCRAADVLLYRPHERPFASSTARGLQPRPPALLPLLLLLLPLLPGRA
AGLEVQRKFLSPTPTNNFALDGPGSRVYLAAVNRLFQLSGGELALEAEAAVGPVLDSPLC
HAPQLPQASCEHPKVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFP
PGGSDPVTVFPSMLNVAANHPNASTVGLVLRRGGGGARLLVAATYTGFGSPFFPRNTSLE
DHRFENTPEIAIRALNARGDLAKLFTFDINPSDDNIFKIKQAAKARHKLSFVRAFLQRGA
APPARRPYAYLALNSEANAGDKESPSHSLLARICLGEPAEATLNGSGETKKLTESYIQLG
LRCGGAADAFTRLVSVFPARAAWSSPAAPGPGPPPAEELLFGVFERAGAGGGGGRPQSAL
CVFRFFVHAGPEGVALGDPRGLLRRADLPVSPQLQPEQLDCGAAHLQHPLAIVNPVTATP
VFTYSGLTAVAVASVNNYTVVFLGTASGGLLKINLDSTMKVISRRSISVAYGEPVHPIMQ
FDPSDSTYLYLMTSHQMTRVKVAACNQYSTCRECLAAADAYCGWCTMETRCSLQRECTNF
TGANFWASASEGVQQCPSMTILEPEINIDKENPALIIQINGTIPNLNGTNISCDYGNNIH
TVARVAGDYVNQFIYCSLLPREKYPTFPDDQDHVVVETALRVNGKNIIRASFTIYDCKRT
GNIYPKRACTSCLSTRWKCHWCPSTYACVSNHSQCDDALQMKKKIDCPRIVPASLDPMPT
GVSRDITISLANATFSKETALECHFGTERTFEARWVNSSAVECLHVLLHTSEKSHLFPVN
LQLKDRPDRFIDSPETMTVEVYNCATGSADCSQCLGREDLGHRCLWSEGSSSCRLHSEPP
QLSDLCPPPEIRKIEPLRGPLEGGTLLTIRGRNLGRRFSDVLGAVRIGSVQCTPLPHRYV
VSEAIVCQTGEAQEAFSDVVTVNVSREGRSKERYSYVLPVVQSIAPLNGPKAGGTRVTIR
GSRLDVGSELRVLVNTSKQCTDLSRNDSTITCTMPSAELTTAVRVCVQFENRSCASYNIT
FKYEKNPVISDINPKKSQISGGRIITLEGRGFELVQNVSMVVRGIGREQTNCKVHTDTVI
TCPSPAASNITAGSKPAPVDFYLNGRLYADDRPALDEEMYPEEALHISKFSLEYYADPQF
FTAKKEKWIKHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLISCEIQIVSDKVIHCSVNE
SLSTSERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSR
RAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRT
FFPKCSSLYEECYVLPSQQLSSQVGSQAQETHPLLVGEWKIPENCRPNMEEGISLFSTLL
NNRHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASK
NPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKA
RYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPY
SQWPRVEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDK
KDTTLSRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKF
LDDLFKAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNILK
NPQFVFDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQR
YYKQIHDMPPLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPT
TKRTQLQHKFDQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_014802111.1.91963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]