SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014811925.1.91963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014811925.1.91963
Domain Number 1 Region: 185-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 132-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000236
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 241-303
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000848
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 80-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000711
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 460-543
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000111
Family Fibronectin type III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014811925.1.91963
Sequence length 699
Comment PREDICTED: sushi domain-containing protein 1 isoform X3 [Calidris pugnax]; AA=GCF_001431845.1; RF=representative genome; TAX=198806; STAX=198806; NAME=Calidris pugnax; AL=Scaffold; RT=Major
Sequence
MSKTETLCEGKSSFITFINLMHKKRLAGVFSCLLFPAIVNRSVSDVCATCHVHATCHQID
GKSVCICNYGFVGNGRTHCQDKDECQIGASKICGNHTLCHNTHGSFYCVCLDGYRASNNN
KTFIPNDGTNCTDIDECEESGLCGRNARCVNTEGSYRCYCNDGYKLENGEHFFHPDGNIV
SCKGVDCGIPPSVLNARAASLSGTTYGSEVTYNCNHGYFIASGNRTAVCNAKGQWDGPDL
VCKEIDCGKPLLIPHTEMIWDNSSTLWSRVYYQCKEGYYFNGDKNFSECTIDQSWETITY
VCKEEELFSNLSVFNETCVKWQRKTGRRGMQEMYTFHILGKRWDEKIFSEDAVFNITTSE
DNPKVCLDLSSGSNYVVNITTISSKNITVSVTVAVHTKVKEAFNNVVIFNETCLKWRRSV
RGTDVEDRYSFHVQGQRWYQKEFFHEMTFNLTTHEKAPEVCFDLQPGTNYSVSISMVALN
FSVLISMTTQITDPPFPDVEFVAVEGSAPLLRLRKVEDRNGPISLYQVIVLPLGLQNTFV
CGSFAAATFFSTTTDAKGYVAAEFRAKDVADNMSIALGDRHYYGKFYNAPLKLGEEYCVF
LRIISEWNKVRTQSCAVWAQIKNLSPALQYMTAVGFGSVAAICLILFLSFSAARSYLHST
VHSPPAALACEAVHLSATMDMAQTGITSSFLETENVSLL
Download sequence
Identical sequences XP_014811925.1.91963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]