SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014840819.1.96476 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014840819.1.96476
Domain Number 1 Region: 154-220
Classification Level Classification E-value
Superfamily Homeodomain-like 5.13e-19
Family Homeodomain 0.0028
Further Details:      
 
Domain Number 2 Region: 33-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000327
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000666
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014840819.1.96476
Sequence length 348
Comment PREDICTED: LIM homeobox transcription factor 1-alpha-like isoform X2 [Poecilia mexicana]; AA=GCF_001443325.1; RF=representative genome; TAX=48701; STAX=48701; NAME=Poecilia mexicana; AL=Scaffold; RT=Major
Sequence
MDQKAVCAGCHRPIRDRFLLRVSDGLWHEECVRCAACGDPLRNSCFLRDRKLFCRRDYAH
LFAVRCGGCAEAISPAELVMRAGAAAFHLRCFTCKVCSCRLQTGDRCVLREGQLLCARED
YHQCLASPASSDTGKSDDEEEEELGRITQRRGVADNPETKRPKRPRTILTTQQRRTFKAS
FEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQEQQHTQEQCELST
VPSCGSLGSEAKCMGPSFAHVQQQQQQQMGLTSLEQQDWDTDPFRQGLTPPQMPGDHMHP
YGFQGLYGEIDTESLCHVADNDCLSLAGSSPLTPIDCLYSMQDSYFTS
Download sequence
Identical sequences XP_014840819.1.96476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]