SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014886123.1.100837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014886123.1.100837
Domain Number 1 Region: 69-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.1e-45
Family Regulator of G-protein signaling, RGS 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014886123.1.100837
Sequence length 205
Comment PREDICTED: regulator of G-protein signaling 13-like isoform X1 [Poecilia latipinna]; AA=GCF_001443285.1; RF=representative genome; TAX=48699; STAX=48699; NAME=Poecilia latipinna; AL=Scaffold; RT=Major
Sequence
MQLENSESSLPKETAHVQSAVAMPSLATLTPPQHLNMDIDKKAIGYSSGGNLKSRLQCKL
SQPSNTEELCFEEMSQWSQSLERLLSSKYGMKIFQAFLKSEFSDENLEFWVVCEDYKKIK
SSFRMSSRAKKIFKLYIQAEAPREINIDHKTREVIRTNMKVASAVCFEEAQKIVFGLMEK
DSYPRFLKSDIYRTLLDSTSAPMRM
Download sequence
Identical sequences A0A087XML8
XP_007554945.1.10163 XP_014844318.1.96476 XP_014886123.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]