SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014888895.1.100837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014888895.1.100837
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.14e-99
Family Sema domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1380-1505,1671-1855
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 854-946
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000266
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 1037-1116
Classification Level Classification E-value
Superfamily E set domains 0.00000000000252
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 5 Region: 944-1036
Classification Level Classification E-value
Superfamily E set domains 0.0000000000154
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000296
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014888895.1.100837
Sequence length 1895
Comment PREDICTED: plexin-D1 isoform X4 [Poecilia latipinna]; AA=GCF_001443285.1; RF=representative genome; TAX=48699; STAX=48699; NAME=Poecilia latipinna; AL=Scaffold; RT=Major
Sequence
MPPSMEIAVLLLGVLALETRRSASALHIQQEFASPNLTNNFVVDPVSRRVYLATVNTVYQ
LNGTLTVEVVKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVMCGS
VYQGFCELRRMGNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDSDIPRKSTGSESK
KLTESYIQMPLQCGANGNIYNRLLSVYPAEVHGGSGGGPEPYLFGVFSKADRNSALCAFK
FGDIEAEIRQGRSNCSNSPSSDVQVLDSVIQGSGAVCIQKGNIVLQPEQLDCGAAHLQHP
LALRRPLRAIPLFGNSALSSVSVDNVHNHTVVFLGTSNGRLHKLTLFPNMTLASQRNMKL
PAGEAVHHIMTFDPNDGNFLYVMTSHHMLRVKVAECDQWKSCTDCLGAKDAYCGWCTLEN
RCTIQNECARGLLPRSWITLGEGPKQCPSITLTPPEISISAKIEAVGILINGSIPDLIGS
KVECEYKPGVSTAATVYGLQIQTCPLLPPENYQPIPPGTDHLTVSVAIKVNGTSVVSGSF
IIYDCERTGQIHPKTSCMSCLSTRWKCYWDQEHHQCLSSKDESKPNLLESAASCPSLIPS
EVPPSPSGMAQDFIVNLSNIQGTEKLECDFGIGWRYEAIWLDNSTVKCSGVTLFTNQRSQ
IYHLSLRRAGYFSSQREDIFLDSPQPMKVEVYNCGAGSSDCSQCWGREDQGHLCGWCESS
CRPRDDCQPDRNVCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRPAGVNIFIGDVPCDL
LPERYTVSVELVCRTGRSLRDGTDSVRVDVDQSGTGTSKESFAYLKPNVESMYPEKGSRA
GGTRVTIRGEHLDIGSQVRVKVNRTQECTITEKTDQTIKCIMPPALEADAELVTVCVEFE
DHPCEEANLSTMYTYEQNPTISFIHPTKSFLSGGRTITVKGHGFDLVQSVIMNVLEIGQT
NCSVLSSSTITCLSPESSQSQETSVQFVLNGVPYTGDSPSSADDRPEEEDGEHHKEHFQL
GYLEDPQFFTTNKDKQIKHHSGEPLTLIINKVPSELELVPEEYSVMIGSYPCNISFHNDQ
LFHCTINGQLSSSESELPVTVQVGNFRHMITKVQLGGSELAIVVSIVVCCVLLLLCTVAL
VVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLE
YKQFVTRTFFPKMCSDYENSLVQPTYVNDSLGPRVLPETHPLLQDWQANNTTRPNVEEGI
TLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSI
DVLTGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKIIEA
FYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGASL
AMSMKDKKENTLERVKDLDTEKYVHLVLPHDELIETKKSHRHSHRKKVLPEIYLTRLLST
KGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPE
YKKKVQCYYKQIQEMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQVVN
ALEANPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_014888895.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]