SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014910809.1.100837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014910809.1.100837
Domain Number 1 Region: 360-416
Classification Level Classification E-value
Superfamily BPTI-like 3.26e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 2 Region: 229-288
Classification Level Classification E-value
Superfamily BPTI-like 1.42e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 3 Region: 136-228
Classification Level Classification E-value
Superfamily PKD domain 0.0000000051
Family PKD domain 0.0054
Further Details:      
 
Domain Number 4 Region: 307-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014910809.1.100837
Sequence length 447
Comment PREDICTED: kunitz-type protease inhibitor 1-like isoform X2 [Poecilia latipinna]; AA=GCF_001443285.1; RF=representative genome; TAX=48699; STAX=48699; NAME=Poecilia latipinna; AL=Scaffold; RT=Major
Sequence
MFRFCTSSLLLLVLLRGARRGAAEQCESGGDAFVSGSENFVLDAKDAVEDGAALLDTQAV
SVDEECETQCCKDPRCNLALLEPRDEETQDTRTCVLFDCVHKNRFVCRFVNQAGYKSYIR
RSTYQRYLEAPGELAPPIANAGPDVVLQPGENVTLNGSESIPLHHAKISDYKWTLQSGDH
SLKLEKTNHDDQVRLSNLQPGSYVLKLTVTDSKGKSGHDTVTIMVLTPELSSLYCLVPPK
TGPCRAAFPRWFYNTTTRRCEKFIYGGCLPNKNNFLFNTECMSACRGVTVSSERSITVNL
HKECGSQCRPNQLTCDDGCCLDRALECDGVSQCSDGSDEKLCSKLSRTFNRLLSVNVSDL
QAQCVEPPRTGPCRAHFHRWYYNPKDRKCLRFIYGGCDENGNNFQDENDCSETCDGVTER
NMFSRGMFDRFGSDDEKTADSAAACSP
Download sequence
Identical sequences XP_014910809.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]