SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014916838.1.86478 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014916838.1.86478
Domain Number 1 Region: 168-423
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-64
Family Eukaryotic proteases 0.000000144
Further Details:      
 
Domain Number 2 Region: 52-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 128-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000763
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014916838.1.86478
Sequence length 427
Comment PREDICTED: complement C1r subcomponent-like protein isoform X2 [Acinonyx jubatus]; AA=GCF_001443585.1; RF=representative genome; TAX=32536; STAX=32536; NAME=Acinonyx jubatus; AL=Scaffold; RT=Major
Sequence
MSSSRCLVSEWGNYLWRSPHSTSCQGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPG
YPEPYVKGQESSSDIEAPEGFAVRLVFQDFDLEPSQDCGQDSVTVSCGVNHSRPSGGSEA
ISIAEDNSSKIQNHCPEPYYQAVPAGALPCTTQGLWKETQDREELPRCEPVCGRPLTPIA
QNQEALGSSKAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSVFPLKNRRVD
VFLGHTSLDEMLRLGSHPVRHVVVHPDYRQNESHDFNGDIALLELQHSVPLGPSLLPVCL
PDSETLYRSGVLGYVSGFGVERGWLTTELKYSRLPVAPRAACQAWLQEKQRSEVFSDNMF
CAGDEMRHQSVCQGDSGGVYVVWDERAHHWVATGIVSWGIGCGKGYGFYTKVLNYLDWIK
GVMGGKD
Download sequence
Identical sequences XP_014916838.1.86478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]