SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014930250.1.86478 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014930250.1.86478
Domain Number 1 Region: 399-636
Classification Level Classification E-value
Superfamily L domain-like 2.67e-40
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 666-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-38
Family Toll/Interleukin receptor TIR domain 0.0000417
Further Details:      
 
Domain Number 3 Region: 25-185,341-438
Classification Level Classification E-value
Superfamily L domain-like 1.56e-37
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014930250.1.86478
Sequence length 833
Comment PREDICTED: toll-like receptor 4 [Acinonyx jubatus]; AA=GCF_001443585.1; RF=representative genome; TAX=32536; STAX=32536; NAME=Acinonyx jubatus; AL=Scaffold; RT=Major
Sequence
MMPPTRLAGTLIPAMAFLSCLRPESWDPCVEVVPNITYQCMDLNLHKIPDNIPSSTKDLD
MSFNPLRNLGSHSFSKFPELQVLDLSRCEIQIIEDDAYQGLNHLSILILTGNPIQRLFPG
AFSGLSSLQTLVVVETNIASLEDFPIGHLKTLKELNVAHNLIHSFKLPEYLSNMPNLEYL
DLSNNKIQNIYHTDLQVLHQKPLLNLSLDLSLNPLDFIQPGAFKEIKLRELTLRSNFNST
DVMKASIQGLAGLQIHQLVLGEFKNERNLERFDKSILEGLCNLIIEKFRIAYFDKFSEDA
IDSFNCLANVSTISLVHLYFNGFKQLPKSLGWQRLELVKCKFEQFPTWKLDSLKELVFSA
NEVGNTFTQVKLESLEFLDLSRNDFSFKSCCSERDLGTTRLKHLDLSFNNIITISSNFLG
LEQLEYLDFQHSSLKQVSDFSVFLPLKNLRYLDISYTHTQVAFHGIFNGLISLQILKMAG
NSFQDNFLPNIFMELTNLTILDLSDCQLEQVSQVAFNSLPKLQLLNMSHNHLLSLDTLPY
EPLHSLQTLDCSFNRIVASKEQELRHFPSNLSSLNLTRNDFACVCEHQSFLQWVKDQRQL
LVEVEQMVCAKPLDMQGMPMLNFRNATCQVRKTIITVSVFTVLLVSLVVVLVYKFYFHLM
LLAGCKKYSRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKLEKSLL
RQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLDGKPRSPEGMADAEGS
Download sequence
Identical sequences XP_014930250.1.86478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]