SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014935812.1.86478 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014935812.1.86478
Domain Number 1 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-20
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 3-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-16
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 286-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000642
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 625-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000228
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 179-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000315
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 484-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000852
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 97-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000134
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014935812.1.86478
Sequence length 684
Comment PREDICTED: zinc finger protein 77-like isoform X2 [Acinonyx jubatus]; AA=GCF_001443585.1; RF=representative genome; TAX=32536; STAX=32536; NAME=Acinonyx jubatus; AL=Scaffold; RT=Major
Sequence
MASVVFEDVAGKFTPEEWALLDRGQRKLYRDVMLETCRNLSSVEKQKFHSNGDLTRMQEG
LLRSPLVESVCERIEGDPCGETLNPITSLTVHEGCPTGGKSCECTKCREAFADGSFLEKP
RRPHPRLKPSPGEECGQACSSVTSLNTHVDADVVEEPCEGQVTGRASETYAKSLRSKKSI
ECKKCGKTFTCTASFKRHVQGHCGQRVHVCDTCGKTFVYHCYLTRHVRIHTGVRPYECQE
CGRAFGYKSSLQNHVRTHAREKPYKYQPGGKAFPGQHSFRIPERKHTGYAPFECKECGKT
FKKRLHFECHMTTHNVVKPYECLECGRAFRHHSDLRVHMRTHTGERPYECKGCGKSFRKY
HHIKRHMVIHSIVKPYECKECDRGFGDQTHLRIHMRTHTGERPYECKQCGKAFRYQWNLR
GHVTTHTRERPYECPECGKAFRYKSCLQEHVTTHTGEKPYECQECGKAFRYKSCLREHMR
RHTGERPNKCQHCGKAFLRHYTLVLHIMRRHSGDGHLECKECGETFRKHRPFERHMTTHN
VVKPYECEECGKTFRYHRDLRIHVRTHTEEKPFKCQHCGKAFPSPSNLGVHMRTHSGGRS
YECQRCGNAFTSPASLRAHMRTHAGERPFECIECGKAFNQLQIFQSHLKTHSTIKSYECK
KCGKVYKFASSLRAHMKKHPGERP
Download sequence
Identical sequences XP_014935812.1.86478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]