SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014936223.1.86478 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014936223.1.86478
Domain Number 1 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 8 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 9 Region: 177-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.54e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 601-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000122
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 11 Region: 107-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000736
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 12 Region: 84-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000648
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014936223.1.86478
Sequence length 652
Comment PREDICTED: zinc finger protein 883-like [Acinonyx jubatus]; AA=GCF_001443585.1; RF=representative genome; TAX=32536; STAX=32536; NAME=Acinonyx jubatus; AL=Scaffold; RT=Major
Sequence
MASSQGLLTFEDVAIEFSQEELIYLNYSQRELYRDVMLENYGHLLFLGLVVSKPDLVNFL
EHKKGVWAVERKETVAIHPENDDECNKYGEAFYQSANLIPHRSIPKGENLYKYIECEKIL
NQSSNVVDQRVHVGRNHYRCNNPGNMFSHSSRLSTHKTTGTGEESYIGNKFGKAFDHQQI
HTGQKPYKCEECGKTFKFCSTLTQHKLTHIGEKPFQCKECGHVFKRLSTFTEHHRIHSGV
KPYQCNKCGKAFNRHSSLTRHQRIHTEEKPYKCQQCGKSFNRSSDFIPHHRIHTGEKPYQ
CKECGKTFNWPASLRVHHRIHTGEKHYKCKECGKAFTHLSSLTNHHRIHTGEKLYQCNEC
GKAFRYFSTFTQHRGIHTGVKPYKCKECGKAFNWHSALKTHQRIHSGEKPYKCQECGKAF
YRQAHLNVHHRIHSGQKPYECKECGKAFSYISNYTQHHRIHIGVKPYKCQECGKAFYRQA
YLNVHHRMHSGEKPHKCQECGKTFNQHSTLREHQGIHTGQKPYQCKECGKAFNWQSALKR
HHRIHSGEKPYQCKECGKTFSQHSSLREHQGIHTGQKPYPCTECGKAFNWPSALKRHHRI
HRGEKPYQCKECGKTFNHHSSRSRHYKTHTGEKPYQYEQCGKTFYHCSTLTY
Download sequence
Identical sequences XP_014936223.1.86478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]