SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014959832.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014959832.1.66739
Domain Number 1 Region: 221-398
Classification Level Classification E-value
Superfamily MIR domain 6.98e-50
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1085-1198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 4023-4101
Classification Level Classification E-value
Superfamily EF-hand 0.00000000077
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 663-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 105-186
Classification Level Classification E-value
Superfamily MIR domain 0.0000034
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 428-552
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000379
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2151-2216
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000994
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014959832.1.66739
Sequence length 4994
Comment PREDICTED: ryanodine receptor 2 isoform X2 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MLNFTVFLSFSFLQDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDL
SICTFVLEQSLSVRALQEMLANTVEKSEGKFMMKTAQGGGHRTLLYGHAILLRHSYSGMY
LCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSE
RYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHLDECLTVPS
GEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLM
EDKSLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHINTG
LWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRF
IRGLDALSKKVKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLF
QEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCA
QFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHK
VLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQ
YKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDG
LHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFF
PVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRD
LLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRD
DNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKN
YQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRN
PRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFR
AEKTYAVKAGRWYFEFEAITSGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGN
EHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGV
AQVGRLNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIE
VTRIDGTIDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTAAGGIPGTGLFG
PKNDLEDYDVDSDFEVLMKTAHGHLVPDRGDKDKEATKPEFNNHKDYAQEKPSRLKQRFL
LRRTKPDYSTSHSARLTEDVLADERDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSD
FHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESLSPGQGRNNNGLEIGC
VVDAASGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAG
LFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCVEPLQFMS
LHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAI
ENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDEKKKHGLP
GIGLSTSLRPRMQFSSPSFVSINTEGYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDP
VGGTTEFLFVPLIKLFYTLLIMGVFHNEDLKHVLQLIEPSVFKEAASPEEESEVAEKEPF
VEDSKLEGAAEEENKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFS
DDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCP
EEIRDQLLDFHEDLMTHCGIELDEDRSLDGNNDLTIRGRLLSLVEKVTYLKKKQAEKPVE
SDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTIN
GVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHE
TVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGL
ASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIG
WNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLSAMEE
AIKIAEDPSRDGPSPTTGSSRTPDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLI
HAAKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMV
LFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLT
RCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLL
RRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIF
DALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTS
NITIPEKLEYFINKYAEHAHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKE
IYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMS
NVTLSRDLHAMAEMMAENYHNIWAKKKKLELEAKGGGNHPLLVPYDTLTAKEKAKDREKA
QDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFVFEVQH
VPKKLFMSTDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGG
HASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVK
SALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQ
HQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETH
LDKHNIYSIYNTKSSRERAALNLPTNVEDVCPNIPSLEKLMEEIVDLAESGIRYTQMPHV
MEVILPMLCSYMSRWWEHGPENNPGRAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGA
WMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKSEARGDMSEAELL
ILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNQEAEDLFRMVAEVFIYWSKSHNFKR
EEQNFVVQNEINNMSFLIMDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLL
PIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDL
PNRTEDTSDPEKTVERVLDIANVLFHLEQKSTCMRRRYYNLVEHPQRSKKAVWHKLLSKQ
RKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEE
DEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSF
EVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAIL
NGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSG
EKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESIS
DFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVG
FLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVES
SNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFL
LSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVL
NYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKM
ELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKEKPEEQGPRMGFFSIMTVKSALF
ALRYNILTLMRMLSLKSLKKQVKKVKKMTVKDMITAFFTSYWSILMSLLHFVASVFRGFS
RIIGSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKTLEGALPSEDLTDL
KELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQEKFQVTYLQS
QQLSGLQEQKANEEEKEEKEESKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEP
EVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKEL
PTRSSSENARVSSLDSSSPRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCL
KVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKV
MDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVV
FTDNSFLYLAWYMTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGL
LAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIED
PAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGI
GNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFP
AGDCFRKQYEDQLN
Download sequence
Identical sequences XP_014959832.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]