SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014962323.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014962323.1.54773
Domain Number 1 Region: 31-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-19
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014962323.1.54773
Sequence length 134
Comment PREDICTED: spermadhesin Z13-like isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MKLSSVIPWALLLSTATSDSTDRLSFKDKNLCGDLYEEEYGVIYPYLGLHTECLWTIKMD
PGHKIVLAVYDLHLNCDKESLEIIDGPPESSSSLKFCDKPYLEYASCTNTMIVKYTRMPN
HPVPNFLLTFRRVL
Download sequence
Identical sequences W5PEB3
XP_014958970.1.66739 XP_014962323.1.54773 ENSOARP00000008777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]