SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014965781.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014965781.1.72884
Domain Number 1 Region: 314-593
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-60
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 17-128
Classification Level Classification E-value
Superfamily POZ domain 8.05e-31
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014965781.1.72884
Sequence length 606
Comment PREDICTED: kelch-like protein 41 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFRE
YFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFT
VCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELI
SVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDD
IIKSNPDLQKKIKVLKDAFTGKLPEPSKNVQKTGAGEVNGDVGDEDLLPGYLNDIPRHGM
FVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENK
DQPLQSYFFQLDSIASEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY
DPVAAKWNEVKKLPIKVYGHNVISHKGMIYCLGGKTDDKKCTNRVFIFNPKKGDWKDLAP
MKTPRSMFGVAVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWDVMTEFPQERSSISLVSL
AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNL
FKLSKL
Download sequence
Identical sequences F7B388 G7PKR8
XP_001104263.1.72884 XP_005573461.1.63531 XP_005573462.1.63531 XP_014965781.1.72884 ENSMMUP00000027009 9544.ENSMMUP00000027009 ENSMMUP00000027009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]