SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014966087.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014966087.1.72884
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily UBA-like 0.000000122
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014966087.1.72884
Sequence length 558
Comment PREDICTED: SPATS2-like protein isoform X3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAELNTHVNVKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWN
MTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEAGPLQPQPPQIQNGPMNGCEKDSSSTDS
ANEKPALVPREKKISIPEEPSKALRGVTEGNRLLQQKLSLDGNPKPIHGTTERSDGLQWS
AEQPCNPSKPKAKTSPVKSNTPAAHLEIKPDELAKKRGPNIEKSVKDLQRCTVSLTRYRV
MIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMEILTARQKKAEELKRLT
DLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKAQIMLCGEITHPKNN
YSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTTDPSHQ
AMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEADPLGKGNNRHEHRRQPHNGFR
PKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTAEARPFRGSVGRVSQCNLCPTRI
EVSTDAAVLSVPAVTLVA
Download sequence
Identical sequences F7HIW4 G7PL52
ENSPANP00000006825 ENSMMUP00000010612 9544.ENSMMUP00000010612 NP_001247524.1.72884 XP_005573916.1.63531 XP_005573917.1.63531 XP_005573918.1.63531 XP_005573919.1.63531 XP_005573920.1.63531 XP_005573921.1.63531 XP_014966087.1.72884 XP_014966088.1.72884 XP_014966089.1.72884 XP_014966093.1.72884 XP_014966094.1.72884 XP_015288644.1.63531 ENSMMUP00000010611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]