SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014969834.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014969834.1.72884
Domain Number 1 Region: 206-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-70
Family Nuclear receptor ligand-binding domain 0.000000000555
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014969834.1.72884
Sequence length 447
Comment PREDICTED: oxysterols receptor LXR-alpha isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSVWLGAPVPDIPPDSAAELWKPGAQDASSQTQGGNSRILREEARMPHSATGTAGVGLEA
AEPTVLLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHAISLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A2K6BY63 F6ST13
XP_011722656.1.29376 XP_014969829.1.72884 XP_014969830.1.72884 XP_014969831.1.72884 XP_014969832.1.72884 XP_014969833.1.72884 XP_014969834.1.72884 ENSMMUP00000020466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]