SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014969835.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014969835.1.72884
Domain Number 1 Region: 161-400
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-70
Family Nuclear receptor ligand-binding domain 0.000000000555
Further Details:      
 
Domain Number 2 Region: 50-136
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-29
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014969835.1.72884
Sequence length 402
Comment PREDICTED: oxysterols receptor LXR-alpha isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPHSATGTAGVGLEAAEPTVLLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKA
SGFHYNVLSCEGCKGFFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMRE
ECVLSEEQIRLKKLKRQEEEQAHAISLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCN
RRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSRED
QIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRA
MNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFP
RMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences XP_014969835.1.72884 XP_014969836.1.72884 ENSMMUP00000037146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]