SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014970509.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014970509.1.72884
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000215
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014970509.1.72884
Sequence length 207
Comment PREDICTED: interleukin-18-binding protein isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MRHNWTPDLSFLWVLLCAHIITLLVRATPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQ
CPALEVTWPEVEMPLNGTLTLSCTACSRFPNFSMLYWLGNGSFIEHLPGQLWEGSTSREH
GSTGTRLYKALVLEQLTPALHSTNFSCVLMDPAQVVQRHVILAQLWAGLRTTLPPTQEAL
PSSHSTGPQQPTAAGLRLSTGPAAARP
Download sequence
Identical sequences B2D0A1
9544.ENSMMUP00000009628 ENSMMUP00000009623 ENSMMUP00000009628 ENSMMUP00000036853 NP_001116825.1.72884 XP_014970507.1.72884 XP_014970508.1.72884 XP_014970509.1.72884 ENSMMUP00000009623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]