SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014971022.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014971022.1.72884
Domain Number 1 Region: 139-382
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.36e-70
Family Fibrinogen C-terminal domain-like 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014971022.1.72884
Sequence length 388
Comment PREDICTED: angiopoietin-related protein 5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MMSPFQVSLLFVNVCIFICGEAVQGNCVHHSTDSSVVNIVEDVSNAKDESKSNDTVCKED
CEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQTSLDYLSNQVNELM
NRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFE
VMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTS
FMLYVSLESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPF
STSDVDNDGCRPACLLNGQSVKSCSHLHNKTGWWFNQCGLANLNGIHHFPGKLLATGIQW
GTWTKNNSPVKIKSVSMKIRRMYNPYFK
Download sequence
Identical sequences F7HC40
9544.ENSMMUP00000027354 ENSMMUP00000027354 ENSMMUP00000027354 XP_014971022.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]