SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014977669.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014977669.1.72884
Domain Number 1 Region: 141-248
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-24
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 359-474
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-23
Family Cadherin 0.0028
Further Details:      
 
Domain Number 3 Region: 249-363
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-17
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 463-572
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 51-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000003
Family Cadherin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014977669.1.72884
Sequence length 772
Comment PREDICTED: cadherin-19 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MNCYLLLPFMLGIPLLWPCLGATENSQTKKVQQPVGSHLRVKRGWVWNQFFVPEEMNTTS
HHVGRLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIEKLDREERSLYILRAQVI
DITTGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSS
GNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTT
SVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDS
QTFDIITNHETQEGIVILKKKVNFEHQNHYGIRAKVKNHHVDEQLMKYHTEASTTFIKIQ
VEDVDEPPLFLLPYYIFEIFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNIDDNG
TITTTNSLDREISAWYNLSITATEKYNIEQISSIPVYVQVLNINDHAPEFSQYYESYVCE
NAGSGQVIQTISAVDRDESIEEHHFYFNLSVEDTNSSSFTIIDNQDNTAVILTNRTGFNL
QEEPIFYISILIADNGIPSLTSTNTLTIHVCDCDDSGSTQTCQYQELMLSMGFKTEVIIA
ILICIMVIFGFIFLTLGLKQRRKQILFPEKSEDFRENIFRYDDEGGGEEDTEAFDVAALR
SSTIMRERKTRKTTSAEIRSLYRQSLQVGPDSAIFRKFILEKLEEADTDPCAPPFDSLQT
YAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPRFKRLACMFGSAVQSNN
Download sequence
Identical sequences A0A1D5QLF4
ENSMMUP00000017791 ENSMMUP00000017791 9544.ENSMMUP00000017791 XP_001094512.1.72884 XP_014977669.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]