SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014978915.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014978915.1.72884
Domain Number 1 Region: 378-517
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000186
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 14-173
Classification Level Classification E-value
Superfamily TPR-like 0.000000272
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014978915.1.72884
Sequence length 613
Comment PREDICTED: MAU2 chromatid cohesion factor homolog isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAAQAAAAAQAAAAQAAQAEAADSWYLALLGFAEHFRTSSPPKIRLCVHCLQAVFPFKPP
QRIEARTHLQLGSVLYHHTKNSEQARSHLEKAWLISQQIPQFEDVKFEAASLLSELYCQE
NSVDAAKPLLRKAIQISQQTPYWHCRLLFQLAQLHTLEKDLVSACDLLGVGAEYARVVGS
EYTRALFLLSKGMLLLMERKLQEVHPLLTLCGQIVENWQGNPIQKESLRVFFLVLQVTHY
LDAGQVKSVKPCLKQLQQCIQTISTLHDDEILPSNPADLFHWLPKEHMCVLVYLVTVMHS
MQAGYLEKAQKYTDKALMQLEKLKMLDCSPILSSFQVILLEHIIMCRLVTGHKATALQEI
SQVCQLCQQSPRLFSNHAAQLHTLLGLYCVSVNCMDNAEAQFTTALRLTNHQELWAFIVT
NLASVYIREGNRHQEVLYSLLERINPDHSFPVSSHCLRAAAFYVRGLFSFFQGRYNEAKR
FLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASKIPDMSVQLW
SSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQ
AQNGPNTSLASLL
Download sequence
Identical sequences A0A0D9QYI2 A0A2I2Z2H5 A0A2J8T5F2 A0A2K5DAB9 A0A2K5IV52 A0A2K5KUW3 A0A2K5RIW0 A0A2K5VWW7 A0A2K6CBF0 A0A2K6LLF0 A0A2K6PKK2 A0A2K6UYF5 F7EW52 H2QFV3 Q9Y6X3
ENSPTRP00000018319 NP_056144.3.87134 NP_056144.3.92137 XP_003942357.1.74449 XP_004060409.1.27298 XP_005588595.1.63531 XP_007994083.1.81039 XP_009251305.1.23681 XP_010385013.1.97406 XP_011715290.1.29376 XP_011781261.1.43180 XP_011949944.1.92194 XP_012298976.1.9421 XP_014978915.1.72884 XP_017708169.1.44346 ENSPTRP00000018318 ENSPANP00000004798 ENSP00000262815 ENSP00000376127 ENSP00000262815 ENSGGOP00000002940 ENSGGOP00000002940 gi|133922609|ref|NP_056144.3| 9598.ENSPTRP00000018319 9600.ENSPPYP00000010941 9606.ENSP00000376127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]