SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014979724.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014979724.1.72884
Domain Number 1 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.49e-42
Family N-terminal domain of cbl (N-cbl) 0.00031
Further Details:      
 
Domain Number 2 Region: 281-358
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-39
Family RING finger domain, C3HC4 0.00015
Further Details:      
 
Domain Number 3 Region: 149-233
Classification Level Classification E-value
Superfamily EF-hand 1.04e-38
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000895
Family SH2 domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014979724.1.72884
Sequence length 428
Comment PREDICTED: E3 ubiquitin-protein ligase CBL-C isoform X4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAVAVAPWGRQWEEARALGRAVRMLQRLEEQCSDPRLSLSPPSLRDLLPRTAQLLREVAS
AQRAAGRGGPGGPGGSRDFLLVYLANLEAKSRQLGALLPPRGRRSANDELFRAGSSLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHVYQLTKAPAHIFWREHCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYLYPDGKNHNPDLTELDQAEAQQRIHVSEEQLQLYWAMDS
TFELCKICAESNKDVKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCKIKGWEAVSIYEFHG
QATAEDSEDGSDQEGRELELEQAPVLAPQLPPRPDLPPRKPRNAQPKVRLLKGSSPPAAL
GPQDPAPA
Download sequence
Identical sequences ENSMMUP00000004361 XP_014979724.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]