SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014980237.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014980237.1.72884
Domain Number 1 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 8 Region: 579-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 416-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000248
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  XP_014980237.1.72884
Domain Number - Region: 174-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00158
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014980237.1.72884
Sequence length 636
Comment PREDICTED: zinc finger protein 528 isoform X3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MKEKESGMALTQGPLKFMDVAIEFSQEEWKCLEPAQRTLYRDVMLENYRNLVSLGICLPD
LSVISTLEQKKDPWILQSEEKIANNPDGRECIKGVNTERSSKLGSNAGNKPCKSQLGFTS
QLHLNDLQLFQAERKISGSKHIEKLINDNSSVSLLEKISSSVKSHLLNKHRNNFDDAPLL
PQKQKAHIREKAYKCNELGQVFRASASLSNHQVIRNADNPYQCNECGKVFSCSSKLVIHR
RMHTGEKPYKCYECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRIHT
GEKPYKCHECDKVFNQIAHLVRHEKIHTGEKPYSCNKCGKVFSRHSYLAEHQTVHTGEKP
YKCKECGKAFSVRSSLITHQLIHTGRKPYKCKECDKVFGRKCLLTSHQRIHTRERPYGCN
QCGKIFSQKSDLIRHRKIHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGK
VFRYKSSLTSHHRIHTGEKPYKCNKCGKVFSRSSNLVCHQKIHTGEKPYKCNECGKVFNQ
ASYLTRHQIIHTGERPYRCNKCGKAFRGCSGLTAHLAIHTEKKSHECKECGKIFTHKSSL
TNHHRIHIGEKPYKCTLCIKVFSHNSDLAQHQRIHS
Download sequence
Identical sequences ENSMMUP00000012541 9544.ENSMMUP00000012541 ENSMMUP00000012541 XP_005590247.1.63531 XP_014980237.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]