SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014981922.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014981922.1.72884
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.27e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  XP_014981922.1.72884
Domain Number - Region: 100-245
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.000994
Family Outer membrane efflux proteins (OEP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014981922.1.72884
Sequence length 309
Comment PREDICTED: THAP domain-containing protein 11 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQQQQQQPSPSASTAQTSQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPTPITPTGEDV
KPIDLTVQVEFAATEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHS
YSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAM
AVIRKKHGM
Download sequence
Identical sequences A0A2K5UNJ1 F6ZKC9
ENSMMUP00000017408 9544.ENSMMUP00000017408 XP_005592350.1.63531 XP_014981922.1.72884 ENSMMUP00000017408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]