SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014986022.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014986022.1.72884
Domain Number 1 Region: 38-326,511-574
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-89
Family FAD-linked reductases, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 333-515
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-55
Family GMC oxidoreductases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014986022.1.72884
Sequence length 594
Comment PREDICTED: choline dehydrogenase, mitochondrial isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MWCLLRGLGRPGALARGALGQQQPLGARALARAGSESRDEYSYVVVGAGSAGCVLAGRLT
EDPAERVLLLEAGPKDVRAGSKRLLWRIHMPAALVANLCDNRYNWCYHTEAQQGLDGRVL
YWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGAGGWDYAHCLPYFRKAQGHELGASRY
RGADGPLRVSRGKTNHPLHCAFLEAAQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSA
ACAYLHPALSRTNLKAEAQTLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAIN
SPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTHPITLHSAQKPLQ
KVCIGLEWLWKFTGKGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY
QVHVGPVRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAP
FRGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENL
RVVDASIMPSVVSGNLNAPTIMIAEKAADIIKGRPVLWDKDVPVYKPRTLATQR
Download sequence
Identical sequences F6SIV5
9544.ENSMMUP00000025315 NP_001244738.1.72884 XP_014986022.1.72884 XP_014986023.1.72884 XP_014986024.1.72884 ENSMMUP00000025315 ENSMMUP00000025315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]