SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014986671.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014986671.1.72884
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.61e-36
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000184
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014986671.1.72884
Sequence length 1029
Comment PREDICTED: zinc finger protein 197 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWEISHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEEL
QKDLDGPAIQVPVLVQDQDTLQKAVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQD
PQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEE
CEWQVLASQWGNETDERADTVKKGSLCERDKKKRTPPEKQGQKWKEFGDSLTFSSAISET
LIGTEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLIDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSSKSNFLDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECQECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECGECGRAFSSNRNLIEH
KRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECLICRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKIHTDEKPCECDVSEKEFCQTSSIHLQQKIHTIEELSWLQNTH
ESKIEIQKI
Download sequence
Identical sequences F6WJT3
ENSMMUP00000023148 9544.ENSMMUP00000023148 ENSMMUP00000023148 XP_014986671.1.72884 XP_014986672.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]