SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014994620.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014994620.1.72884
Domain Number 1 Region: 438-683
Classification Level Classification E-value
Superfamily vWA-like 7.11e-70
Family Trunk domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 2 Region: 191-455
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.94e-38
Family beta-sandwich domain of Sec23/24 0.0048
Further Details:      
 
Domain Number 3 Region: 686-781
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.62e-36
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 4 Region: 888-1029
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.02e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 5 Region: 782-887
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.1e-29
Family Helical domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014994620.1.72884
Sequence length 1033
Comment PREDICTED: protein transport protein Sec24D isoform X4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSQQGYVATPPYSQPQPGIGLSPPHYGHYGDPSHTASPTGMMKPAGPLGVTATGGMLPPG
PPPPGPHQFGQNGAHAAGHPQQRFPGPPPVNNVASSYAPYQPSAQSSYPSPMSTSSVTQL
GSQLSAMQINSYGSGMAPPSQGPPGPLSATSLQTPPRPPQPSILQPGSQVLPPPPTTLNG
PGASPLLPPMYRPDGLSGPPPPNSQYQPTPLPGQTLGAGYPPQQAANSGPQMAGAQLSYP
GGFPGGPAQLAGPPQPQKKLDPDSIPSPIQVIENDRASRGGQVYATNTRGQIPPLVTTDC
IIQDQGNASPRFIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNESPLYLVNHGESG
PVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSL
GSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTMLEKLPKEEQEE
MSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNL
LDQIPDMFADSNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDK
KLVNTDKEKILFQPQTNVYDSLAKDCVAHGCSVTLFLFPSQYVDVASLGLVPQLTGGTLY
KYNNFQMHLDRQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGILMNNTTDVEMA
AIDCDKAVTVEFKHDDKLSEDTGALIQCAVLYTTISGQRRLRIHNLGLNCSSQLADLYKS
CETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSM
KVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKS
TMLPAAVRCSESRLSEEGIFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLL
PEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDF
LCCVHKEICQLLN
Download sequence
Identical sequences 9544.ENSMMUP00000009557 XP_002804229.1.72884 XP_014994620.1.72884 ENSMMUP00000009557 ENSMMUP00000009557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]