SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014994921.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014994921.1.72884
Domain Number 1 Region: 280-376
Classification Level Classification E-value
Superfamily Immunoglobulin 8.11e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 398-730
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000183
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.046
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000152
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000155
Family I set domains 0.091
Further Details:      
 
Domain Number 5 Region: 125-197
Classification Level Classification E-value
Superfamily EF-hand 0.00000000559
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014994921.1.72884
Sequence length 792
Comment PREDICTED: follistatin-related protein 5 isoform X3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MIQDGPFGSCENKYCGLGRHCVIGRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVH
RAACLKKEKITIVHNEDCFFKGDKCETTEYSKMKNKLLDLQNQKYIMQENENPNDDDISQ
KKLLVDQMFKYFDADSNGLVAINELTQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLAL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWERNNIILNNLDLE
DINDFGDDGSLYITKVTTTHMGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRH
IKPSEKLLGFQDEVCPKAEGDEVQSCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQF
DRVDDFFIPTTTLIITHMRFGFVLHKDEAALQKIDLETMSYIKTINLKDYKCIPQSLAYT
HLGGYYFIGCKPDSTRAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGL
VRVQYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGK
VKMIKSLKEPLKAEEWPWNQKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEV
EKGNTVIWVGDA
Download sequence
Identical sequences XP_014994921.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]