SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014995425.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014995425.1.72884
Domain Number 1 Region: 543-732
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 336-522
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-16
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000113
Family Fibronectin type III 0.0038
Further Details:      
 
Weak hits

Sequence:  XP_014995425.1.72884
Domain Number - Region: 150-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0926
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014995425.1.72884
Sequence length 977
Comment PREDICTED: oncostatin-M-specific receptor subunit beta isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MALFVVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSIHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVVWVGNYSTPVKWNQVLHWSWESELPLECATHFVRIKSVIDD
ASFPEPNFWSNWSSWEEVSVQDYLGRGTLFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNRGTNIYCEASQGNVSKGIEGIVLFVSKVLEEP
KDFSCESQDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQEMYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQYDVSINVNGEYFLSELEPATEYMARVRCADASHFWKWTEWSG
QNFTTLEAAPSEAPDVWRSVNSEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSR
SELRSIPAPANSTKLILDRCSYQICVTANNSVGASPASIIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHPQDVLQWKNVGPNTTSTVISTDAFRPGVRYDFRIYG
LSTKRIACLLEKKTGYSQELAPSDNPHVLVDMLTSHSFTLSWKDYSTESQPGFIQGYHVY
LKSKARQCHPRFQKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFVTPFTSAGEG
PNATFTKVTTPDEHSSMLIRILLPMVFCVLLIMIVCYLKSQWIKETCYPDIPDPYKSSIL
SLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQLLGTRKSLTETELTKPNYLYLLPT
EKNHSGPGPCICFENFTYNQAASDAGSCGHVPVPPKAPPSMLGLMTSPENVLKALEKNYM
NSLGEVPAGETSLNYVSQLASPMSGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPPPTE
NSSLSSITLLDPGEHYR
Download sequence
Identical sequences A0A2K5UFW5 F7GUY2
ENSMMUP00000002150 9544.ENSMMUP00000002150 ENSMMUP00000002150 XP_001083745.1.72884 XP_005556828.1.63531 XP_005556829.1.63531 XP_014995425.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]