SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014995944.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014995944.1.72884
Domain Number 1 Region: 17-133
Classification Level Classification E-value
Superfamily ISP domain 1.96e-25
Family Rieske iron-sulfur protein (ISP) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014995944.1.72884
Sequence length 158
Comment PREDICTED: Rieske domain-containing protein [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MNLDGSAQDPKKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIH
TVTVDNGNIYVTLSSEPFKCDSDFYATGDFKVIKSSSR
Download sequence
Identical sequences G7MVB1
9544.ENSMMUP00000001615 XP_001093050.1.72884 XP_014995941.1.72884 XP_014995942.1.72884 XP_014995943.1.72884 XP_014995944.1.72884 ENSMMUP00000001615 ENSMMUP00000001615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]