SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014995987.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014995987.1.72884
Domain Number 1 Region: 194-351
Classification Level Classification E-value
Superfamily PHM/PNGase F 4.87e-56
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000000501
Further Details:      
 
Domain Number 2 Region: 45-191
Classification Level Classification E-value
Superfamily PHM/PNGase F 3.98e-52
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000000603
Further Details:      
 
Domain Number 3 Region: 512-810
Classification Level Classification E-value
Superfamily NHL repeat 5.75e-35
Family NHL repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014995987.1.72884
Sequence length 907
Comment PREDICTED: peptidyl-glycine alpha-amidating monooxygenase isoform X7 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAGRVPSLLVLLLVFPSSCLAFRSPLSVFKRFKETTRPFSNECLGTTRPVIPIDSTDFAL
DIRMPGVIPKQSDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYW
FCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHK
DCSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTH
HLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDLLAARCVFTGEGRTEAT
HIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDTFRTIPPEANIPIPVKSDMVMMH
EHHKETEYKDKIPLLQQPKREEEEVLDQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESE
SDLVAEIANVVQKKDLGRSDAREGAEHERGNAILVRDRIHKFHRLVSTLRPPESRVSSLQ
QPLPGEGTWEPEHTGDFHMEEALDWPGVYLLPGQVSGVALDPKNNLVIFHRGDHVWDGNS
FDSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVAL
HQVFKLDPNNKEGPILILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQF
SPSGEFITQWGEESSGSSPLPGQFTVPHSLALVSHLGQLCVADRENARIQCFKTDTKEFV
REIKHSSFGRNVFAISYIPGLLFAVNGKPHFGDQEPVQGFVMNFSSGEIIDIFKPVRKHF
DMPHDIVASEDGTVYIGDAHTNTVWKFTLTEKVEHRSVKKAGIEVQEIKDSEHKLETSSG
RVLGRFRGKGSGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEEDDGSESEEEYSAPLP
APAPSSS
Download sequence
Identical sequences XP_014995987.1.72884 ENSMMUP00000010305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]